PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0631s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Trihelix
Protein Properties Length: 274aa    MW: 30287.3 Da    PI: 7.252
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0631s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix31.25.8e-102290270
             trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70
                         Wt    l+L++  + +e +  ++ +  ++W+ +s+++++ g++r+  qC+ +w++l  +y  ik ++++
  Kaladp0631s0002.1.p 22 WTLTDSLTLVNEISAVEADCLDALSYYQKWKIISDNCAALGVNRTLDQCRRRWDSLFADYNSIKLWDED 90
                         9999999999999999999999999**************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.7E-82292No hitNo description
PROSITE profilePS500906.762278IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MPPKKTEESA SRRTRSQVAP DWTLTDSLTL VNEISAVEAD CLDALSYYQK WKIISDNCAA  60
LGVNRTLDQC RRRWDSLFAD YNSIKLWDED GGGYWGLGGE RRRGIGLPEE FDRDLFNAVD  120
VVVKGQVERA SSRHDAVLGD ADADPLGVIS PPVFKKQNHQ LTPLKRQIEV KKEKQIVGDK  180
KTGPMEVMAT QKGEKATSSS VEVMASQLRE KAEMIQAILE GKIAENKDYT LSDLKQGAAS  240
RANLARRQGD KLIDCFGAIG STLDQLCKVT LTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.14e-45sequence-specific DNA binding transcription factors